Anti SCML1 pAb (ATL-HPA061397)

Atlas Antibodies

Catalog No.: ATL-HPA061397-25

Protein Description: sex comb on midleg-like 1 (Drosophila)
Gene Name: SCML1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027550: 28%, ENSRNOG00000034174: 30%
Entrez Gene ID: 6322
Uniprot ID: Q9UN30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHVRSL
• Gene Sequence: SNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHVRSL
• Gene ID - Mouse: ENSMUSG00000027550
• Gene ID - Rat: ENSRNOG00000034174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.