Anti SCML1 pAb (ATL-HPA061397)

Atlas Antibodies

Catalog No.:
ATL-HPA061397-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sex comb on midleg-like 1 (Drosophila)
Gene Name: SCML1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027550: 28%, ENSRNOG00000034174: 30%
Entrez Gene ID: 6322
Uniprot ID: Q9UN30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHVRSL
Gene Sequence SNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHVRSL
Gene ID - Mouse ENSMUSG00000027550
Gene ID - Rat ENSRNOG00000034174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCML1 pAb (ATL-HPA061397)
Datasheet Anti SCML1 pAb (ATL-HPA061397) Datasheet (External Link)
Vendor Page Anti SCML1 pAb (ATL-HPA061397) at Atlas Antibodies

Documents & Links for Anti SCML1 pAb (ATL-HPA061397)
Datasheet Anti SCML1 pAb (ATL-HPA061397) Datasheet (External Link)
Vendor Page Anti SCML1 pAb (ATL-HPA061397)