Anti SCMH1 pAb (ATL-HPA053292)

Atlas Antibodies

Catalog No.:
ATL-HPA053292-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sex comb on midleg homolog 1 (Drosophila)
Gene Name: SCMH1
Alternative Gene Name: Scml3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000085: 87%, ENSRNOG00000032183: 88%
Entrez Gene ID: 22955
Uniprot ID: Q96GD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRGVLKGSNERRDMESFWKLNRSPGSDRYLESRDASRLSGRDPSSWTVEDVMQFVREADPQLGPHAD
Gene Sequence SRGVLKGSNERRDMESFWKLNRSPGSDRYLESRDASRLSGRDPSSWTVEDVMQFVREADPQLGPHAD
Gene ID - Mouse ENSMUSG00000000085
Gene ID - Rat ENSRNOG00000032183
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCMH1 pAb (ATL-HPA053292)
Datasheet Anti SCMH1 pAb (ATL-HPA053292) Datasheet (External Link)
Vendor Page Anti SCMH1 pAb (ATL-HPA053292) at Atlas Antibodies

Documents & Links for Anti SCMH1 pAb (ATL-HPA053292)
Datasheet Anti SCMH1 pAb (ATL-HPA053292) Datasheet (External Link)
Vendor Page Anti SCMH1 pAb (ATL-HPA053292)