Anti SCMH1 pAb (ATL-HPA053292)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053292-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SCMH1
Alternative Gene Name: Scml3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000085: 87%, ENSRNOG00000032183: 88%
Entrez Gene ID: 22955
Uniprot ID: Q96GD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRGVLKGSNERRDMESFWKLNRSPGSDRYLESRDASRLSGRDPSSWTVEDVMQFVREADPQLGPHAD |
| Gene Sequence | SRGVLKGSNERRDMESFWKLNRSPGSDRYLESRDASRLSGRDPSSWTVEDVMQFVREADPQLGPHAD |
| Gene ID - Mouse | ENSMUSG00000000085 |
| Gene ID - Rat | ENSRNOG00000032183 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCMH1 pAb (ATL-HPA053292) | |
| Datasheet | Anti SCMH1 pAb (ATL-HPA053292) Datasheet (External Link) |
| Vendor Page | Anti SCMH1 pAb (ATL-HPA053292) at Atlas Antibodies |
| Documents & Links for Anti SCMH1 pAb (ATL-HPA053292) | |
| Datasheet | Anti SCMH1 pAb (ATL-HPA053292) Datasheet (External Link) |
| Vendor Page | Anti SCMH1 pAb (ATL-HPA053292) |