Anti SCLY pAb (ATL-HPA055760)

Atlas Antibodies

SKU:
ATL-HPA055760-100
  • Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
  • Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: selenocysteine lyase
Gene Name: SCLY
Alternative Gene Name: SCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026307: 90%, ENSRNOG00000020083: 91%
Entrez Gene ID: 51540
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Gene Sequence LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Gene ID - Mouse ENSMUSG00000026307
Gene ID - Rat ENSRNOG00000020083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCLY pAb (ATL-HPA055760)
Datasheet Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link)
Vendor Page Anti SCLY pAb (ATL-HPA055760) at Atlas Antibodies

Documents & Links for Anti SCLY pAb (ATL-HPA055760)
Datasheet Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link)
Vendor Page Anti SCLY pAb (ATL-HPA055760)