Anti SCG3 pAb (ATL-HPA006880 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006880-25

Protein Description: secretogranin III
Gene Name: SCG3
Alternative Gene Name: FLJ90833, SGIII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032181: 87%, ENSRNOG00000010784: 88%
Entrez Gene ID: 29106
Uniprot ID: Q8WXD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
• Gene Sequence: LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
• Gene ID - Mouse: ENSMUSG00000032181
• Gene ID - Rat: ENSRNOG00000010784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCG3 pAb (ATL-HPA006880 w/enhanced validation) – 3 Found

Leja, Justyna; Essaghir, Ahmed; Essand, Magnus; Wester, Kenneth; Oberg, Kjell; Tötterman, Thomas H; Lloyd, Ricardo; Vasmatzis, George; Demoulin, Jean-Baptiste; Giandomenico, Valeria. Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2009;22(2):261-72. 

Canzano, Joseph S; Nasif, Lith H; Butterworth, Elizabeth A; Fu, Dongtao A; Atkinson, Mark A; Campbell-Thompson, Martha. Islet Microvasculature Alterations With Loss of Beta-cells in Patients With Type 1 Diabetes. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2019;67(1):41-52. 

Barranco, Neus; Plá, Virginia; Alcolea, Daniel; Sánchez-Domínguez, Irene; Fischer-Colbrie, Reiner; Ferrer, Isidro; Lleó, Alberto; Aguado, Fernando. Dense core vesicle markers in CSF and cortical tissues of patients with Alzheimer's disease. Translational Neurodegeneration. 2021;10(1):37.