Anti SCCPDH pAb (ATL-HPA076030 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA076030-25

• 
• 

Protein Description: saccharopine dehydrogenase (putative)
Gene Name: SCCPDH
Alternative Gene Name: CGI-49, NET11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038936: 85%, ENSRNOG00000037984: 81%
Entrez Gene ID: 51097
Uniprot ID: Q8NBX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTVG
• Gene Sequence: KRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTVG
• Gene ID - Mouse: ENSMUSG00000038936
• Gene ID - Rat: ENSRNOG00000037984
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.