Anti SCARB1 pAb (ATL-HPA066285)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066285-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SCARB1
Alternative Gene Name: CD36L1, CLA-1, CLA1, SR-BI, SRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037936: 78%, ENSRNOG00000000981: 76%
Entrez Gene ID: 949
Uniprot ID: Q8WTV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGA |
| Gene Sequence | PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGA |
| Gene ID - Mouse | ENSMUSG00000037936 |
| Gene ID - Rat | ENSRNOG00000000981 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCARB1 pAb (ATL-HPA066285) | |
| Datasheet | Anti SCARB1 pAb (ATL-HPA066285) Datasheet (External Link) |
| Vendor Page | Anti SCARB1 pAb (ATL-HPA066285) at Atlas Antibodies |
| Documents & Links for Anti SCARB1 pAb (ATL-HPA066285) | |
| Datasheet | Anti SCARB1 pAb (ATL-HPA066285) Datasheet (External Link) |
| Vendor Page | Anti SCARB1 pAb (ATL-HPA066285) |