Anti SCAMP3 pAb (ATL-HPA071167)

Atlas Antibodies

Catalog No.:
ATL-HPA071167-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: secretory carrier membrane protein 3
Gene Name: SCAMP3
Alternative Gene Name: C1orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028049: 87%, ENSRNOG00000020500: 86%
Entrez Gene ID: 10067
Uniprot ID: O14828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP
Gene Sequence MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP
Gene ID - Mouse ENSMUSG00000028049
Gene ID - Rat ENSRNOG00000020500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCAMP3 pAb (ATL-HPA071167)
Datasheet Anti SCAMP3 pAb (ATL-HPA071167) Datasheet (External Link)
Vendor Page Anti SCAMP3 pAb (ATL-HPA071167) at Atlas Antibodies

Documents & Links for Anti SCAMP3 pAb (ATL-HPA071167)
Datasheet Anti SCAMP3 pAb (ATL-HPA071167) Datasheet (External Link)
Vendor Page Anti SCAMP3 pAb (ATL-HPA071167)