Anti SCAMP3 pAb (ATL-HPA071167)

Atlas Antibodies

Catalog No.: ATL-HPA071167-25

Protein Description: secretory carrier membrane protein 3
Gene Name: SCAMP3
Alternative Gene Name: C1orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028049: 87%, ENSRNOG00000020500: 86%
Entrez Gene ID: 10067
Uniprot ID: O14828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP
• Gene Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP
• Gene ID - Mouse: ENSMUSG00000028049
• Gene ID - Rat: ENSRNOG00000020500
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.