Anti SCAMP3 pAb (ATL-HPA071167)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071167-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SCAMP3
Alternative Gene Name: C1orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028049: 87%, ENSRNOG00000020500: 86%
Entrez Gene ID: 10067
Uniprot ID: O14828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP |
Gene Sequence | MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP |
Gene ID - Mouse | ENSMUSG00000028049 |
Gene ID - Rat | ENSRNOG00000020500 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SCAMP3 pAb (ATL-HPA071167) | |
Datasheet | Anti SCAMP3 pAb (ATL-HPA071167) Datasheet (External Link) |
Vendor Page | Anti SCAMP3 pAb (ATL-HPA071167) at Atlas Antibodies |
Documents & Links for Anti SCAMP3 pAb (ATL-HPA071167) | |
Datasheet | Anti SCAMP3 pAb (ATL-HPA071167) Datasheet (External Link) |
Vendor Page | Anti SCAMP3 pAb (ATL-HPA071167) |