Anti SCAMP2 pAb (ATL-HPA014699)

Atlas Antibodies

Catalog No.:
ATL-HPA014699-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: secretory carrier membrane protein 2
Gene Name: SCAMP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040188: 92%, ENSRNOG00000019136: 92%
Entrez Gene ID: 10066
Uniprot ID: O15127
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHV
Gene Sequence DPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHV
Gene ID - Mouse ENSMUSG00000040188
Gene ID - Rat ENSRNOG00000019136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCAMP2 pAb (ATL-HPA014699)
Datasheet Anti SCAMP2 pAb (ATL-HPA014699) Datasheet (External Link)
Vendor Page Anti SCAMP2 pAb (ATL-HPA014699) at Atlas Antibodies

Documents & Links for Anti SCAMP2 pAb (ATL-HPA014699)
Datasheet Anti SCAMP2 pAb (ATL-HPA014699) Datasheet (External Link)
Vendor Page Anti SCAMP2 pAb (ATL-HPA014699)