Anti SCAF8 pAb (ATL-HPA035601 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035601-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-SCAF8 antibody HPA035601 (A) shows similar protein distribution across tissues to independent antibody HPA035602 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SR-related CTD-associated factor 8
Gene Name: SCAF8
Alternative Gene Name: KIAA1116, RBM16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046201: 78%, ENSRNOG00000016919: 79%
Entrez Gene ID: 22828
Uniprot ID: Q9UPN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG
Gene Sequence LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG
Gene ID - Mouse ENSMUSG00000046201
Gene ID - Rat ENSRNOG00000016919
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCAF8 pAb (ATL-HPA035601 w/enhanced validation)
Datasheet Anti SCAF8 pAb (ATL-HPA035601 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCAF8 pAb (ATL-HPA035601 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SCAF8 pAb (ATL-HPA035601 w/enhanced validation)
Datasheet Anti SCAF8 pAb (ATL-HPA035601 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCAF8 pAb (ATL-HPA035601 w/enhanced validation)