Anti SCAF1 pAb (ATL-HPA046828)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046828-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SCAF1
Alternative Gene Name: FLJ00034, SR-A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038406: 91%, ENSRNOG00000056946: 91%
Entrez Gene ID: 58506
Uniprot ID: Q9H7N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT |
Gene Sequence | SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT |
Gene ID - Mouse | ENSMUSG00000038406 |
Gene ID - Rat | ENSRNOG00000056946 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SCAF1 pAb (ATL-HPA046828) | |
Datasheet | Anti SCAF1 pAb (ATL-HPA046828) Datasheet (External Link) |
Vendor Page | Anti SCAF1 pAb (ATL-HPA046828) at Atlas Antibodies |
Documents & Links for Anti SCAF1 pAb (ATL-HPA046828) | |
Datasheet | Anti SCAF1 pAb (ATL-HPA046828) Datasheet (External Link) |
Vendor Page | Anti SCAF1 pAb (ATL-HPA046828) |