Anti SC5D pAb (ATL-HPA066283)

Atlas Antibodies

Catalog No.:
ATL-HPA066283-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sterol-C5-desaturase
Gene Name: SC5D
Alternative Gene Name: SC5DL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032018: 84%, ENSRNOG00000008305: 81%
Entrez Gene ID: 6309
Uniprot ID: O75845
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLVLRVADYYFFTPYVYPATWPEDDIFRQAI
Gene Sequence DLVLRVADYYFFTPYVYPATWPEDDIFRQAI
Gene ID - Mouse ENSMUSG00000032018
Gene ID - Rat ENSRNOG00000008305
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SC5D pAb (ATL-HPA066283)
Datasheet Anti SC5D pAb (ATL-HPA066283) Datasheet (External Link)
Vendor Page Anti SC5D pAb (ATL-HPA066283) at Atlas Antibodies

Documents & Links for Anti SC5D pAb (ATL-HPA066283)
Datasheet Anti SC5D pAb (ATL-HPA066283) Datasheet (External Link)
Vendor Page Anti SC5D pAb (ATL-HPA066283)