Anti SBSN pAb (ATL-HPA062568 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062568-25
  • Immunohistochemistry analysis in human skin and kidney tissues using HPA062568 antibody. Corresponding SBSN RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: suprabasin
Gene Name: SBSN
Alternative Gene Name: HLAR698, UNQ698
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046056: 55%, ENSRNOG00000021015: 50%
Entrez Gene ID: 374897
Uniprot ID: Q6UWP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH
Gene Sequence KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH
Gene ID - Mouse ENSMUSG00000046056
Gene ID - Rat ENSRNOG00000021015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SBSN pAb (ATL-HPA062568 w/enhanced validation)
Datasheet Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SBSN pAb (ATL-HPA062568 w/enhanced validation)
Datasheet Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SBSN pAb (ATL-HPA062568 w/enhanced validation)