Anti SBK3 pAb (ATL-HPA078322)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078322-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SBK3
Alternative Gene Name: SgK110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085272: 85%, ENSRNOG00000042927: 77%
Entrez Gene ID: 100130827
Uniprot ID: P0C264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY |
| Gene Sequence | EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY |
| Gene ID - Mouse | ENSMUSG00000085272 |
| Gene ID - Rat | ENSRNOG00000042927 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SBK3 pAb (ATL-HPA078322) | |
| Datasheet | Anti SBK3 pAb (ATL-HPA078322) Datasheet (External Link) |
| Vendor Page | Anti SBK3 pAb (ATL-HPA078322) at Atlas Antibodies |
| Documents & Links for Anti SBK3 pAb (ATL-HPA078322) | |
| Datasheet | Anti SBK3 pAb (ATL-HPA078322) Datasheet (External Link) |
| Vendor Page | Anti SBK3 pAb (ATL-HPA078322) |