Anti SBK3 pAb (ATL-HPA078322)

Atlas Antibodies

Catalog No.:
ATL-HPA078322-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SH3 domain binding kinase family member 3
Gene Name: SBK3
Alternative Gene Name: SgK110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085272: 85%, ENSRNOG00000042927: 77%
Entrez Gene ID: 100130827
Uniprot ID: P0C264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY
Gene Sequence EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY
Gene ID - Mouse ENSMUSG00000085272
Gene ID - Rat ENSRNOG00000042927
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SBK3 pAb (ATL-HPA078322)
Datasheet Anti SBK3 pAb (ATL-HPA078322) Datasheet (External Link)
Vendor Page Anti SBK3 pAb (ATL-HPA078322) at Atlas Antibodies

Documents & Links for Anti SBK3 pAb (ATL-HPA078322)
Datasheet Anti SBK3 pAb (ATL-HPA078322) Datasheet (External Link)
Vendor Page Anti SBK3 pAb (ATL-HPA078322)