Anti SBF2 pAb (ATL-HPA050933)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050933-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SBF2
Alternative Gene Name: CMT4B2, DENND7B, KIAA1766, MTMR13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038371: 63%, ENSRNOG00000009812: 67%
Entrez Gene ID: 81846
Uniprot ID: Q86WG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR |
Gene Sequence | NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR |
Gene ID - Mouse | ENSMUSG00000038371 |
Gene ID - Rat | ENSRNOG00000009812 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SBF2 pAb (ATL-HPA050933) | |
Datasheet | Anti SBF2 pAb (ATL-HPA050933) Datasheet (External Link) |
Vendor Page | Anti SBF2 pAb (ATL-HPA050933) at Atlas Antibodies |
Documents & Links for Anti SBF2 pAb (ATL-HPA050933) | |
Datasheet | Anti SBF2 pAb (ATL-HPA050933) Datasheet (External Link) |
Vendor Page | Anti SBF2 pAb (ATL-HPA050933) |