Anti SBF2 pAb (ATL-HPA050933)

Atlas Antibodies

Catalog No.:
ATL-HPA050933-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SET binding factor 2
Gene Name: SBF2
Alternative Gene Name: CMT4B2, DENND7B, KIAA1766, MTMR13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038371: 63%, ENSRNOG00000009812: 67%
Entrez Gene ID: 81846
Uniprot ID: Q86WG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR
Gene Sequence NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR
Gene ID - Mouse ENSMUSG00000038371
Gene ID - Rat ENSRNOG00000009812
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SBF2 pAb (ATL-HPA050933)
Datasheet Anti SBF2 pAb (ATL-HPA050933) Datasheet (External Link)
Vendor Page Anti SBF2 pAb (ATL-HPA050933) at Atlas Antibodies

Documents & Links for Anti SBF2 pAb (ATL-HPA050933)
Datasheet Anti SBF2 pAb (ATL-HPA050933) Datasheet (External Link)
Vendor Page Anti SBF2 pAb (ATL-HPA050933)