Anti SBF1 pAb (ATL-HPA074004)

Atlas Antibodies

Catalog No.:
ATL-HPA074004-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SET binding factor 1
Gene Name: SBF1
Alternative Gene Name: DENND7A, MTMR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036529: 89%, ENSRNOG00000008392: 89%
Entrez Gene ID: 6305
Uniprot ID: O95248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYL
Gene Sequence CYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYL
Gene ID - Mouse ENSMUSG00000036529
Gene ID - Rat ENSRNOG00000008392
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SBF1 pAb (ATL-HPA074004)
Datasheet Anti SBF1 pAb (ATL-HPA074004) Datasheet (External Link)
Vendor Page Anti SBF1 pAb (ATL-HPA074004) at Atlas Antibodies

Documents & Links for Anti SBF1 pAb (ATL-HPA074004)
Datasheet Anti SBF1 pAb (ATL-HPA074004) Datasheet (External Link)
Vendor Page Anti SBF1 pAb (ATL-HPA074004)