Anti SAT1 pAb (ATL-HPA055312)

Atlas Antibodies

Catalog No.:
ATL-HPA055312-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: spermidine/spermine N1-acetyltransferase 1
Gene Name: SAT1
Alternative Gene Name: SAT, SSAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025283: 95%, ENSRNOG00000003809: 95%
Entrez Gene ID: 6303
Uniprot ID: P21673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLV
Gene Sequence RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLV
Gene ID - Mouse ENSMUSG00000025283
Gene ID - Rat ENSRNOG00000003809
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAT1 pAb (ATL-HPA055312)
Datasheet Anti SAT1 pAb (ATL-HPA055312) Datasheet (External Link)
Vendor Page Anti SAT1 pAb (ATL-HPA055312) at Atlas Antibodies

Documents & Links for Anti SAT1 pAb (ATL-HPA055312)
Datasheet Anti SAT1 pAb (ATL-HPA055312) Datasheet (External Link)
Vendor Page Anti SAT1 pAb (ATL-HPA055312)