Anti SASH1 pAb (ATL-HPA029949)

Atlas Antibodies

Catalog No.: ATL-HPA029949-25

Protein Description: SAM and SH3 domain containing 1
Gene Name: SASH1
Alternative Gene Name: dJ323M4.1, KIAA0790, SH3D6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015305: 95%, ENSRNOG00000013160: 96%
Entrez Gene ID: 23328
Uniprot ID: O94885
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETE
• Gene Sequence: KGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETE
• Gene ID - Mouse: ENSMUSG00000015305
• Gene ID - Rat: ENSRNOG00000013160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.