Anti SARS2 pAb (ATL-HPA052730)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052730-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SARS2
Alternative Gene Name: FLJ20450, mtSerRS, SARS, SARSM, SerRSmt, SERS, SYS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070699: 91%, ENSRNOG00000019962: 89%
Entrez Gene ID: 54938
Uniprot ID: Q9NP81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGL |
| Gene Sequence | QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGL |
| Gene ID - Mouse | ENSMUSG00000070699 |
| Gene ID - Rat | ENSRNOG00000019962 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SARS2 pAb (ATL-HPA052730) | |
| Datasheet | Anti SARS2 pAb (ATL-HPA052730) Datasheet (External Link) |
| Vendor Page | Anti SARS2 pAb (ATL-HPA052730) at Atlas Antibodies |
| Documents & Links for Anti SARS2 pAb (ATL-HPA052730) | |
| Datasheet | Anti SARS2 pAb (ATL-HPA052730) Datasheet (External Link) |
| Vendor Page | Anti SARS2 pAb (ATL-HPA052730) |