Anti SARAF pAb (ATL-HPA040400)

Atlas Antibodies

Catalog No.:
ATL-HPA040400-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: store-operated calcium entry-associated regulatory factor
Gene Name: SARAF
Alternative Gene Name: MGC8721, TMEM66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031532: 75%, ENSRNOG00000012329: 70%
Entrez Gene ID: 51669
Uniprot ID: Q96BY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT
Gene Sequence YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT
Gene ID - Mouse ENSMUSG00000031532
Gene ID - Rat ENSRNOG00000012329
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SARAF pAb (ATL-HPA040400)
Datasheet Anti SARAF pAb (ATL-HPA040400) Datasheet (External Link)
Vendor Page Anti SARAF pAb (ATL-HPA040400) at Atlas Antibodies

Documents & Links for Anti SARAF pAb (ATL-HPA040400)
Datasheet Anti SARAF pAb (ATL-HPA040400) Datasheet (External Link)
Vendor Page Anti SARAF pAb (ATL-HPA040400)