Anti SAR1B pAb (ATL-HPA048368)

Atlas Antibodies

Catalog No.:
ATL-HPA048368-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: secretion associated, Ras related GTPase 1B
Gene Name: SAR1B
Alternative Gene Name: SARA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020386: 100%, ENSRNOG00000004820: 99%
Entrez Gene ID: 51128
Uniprot ID: Q9Y6B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE
Gene Sequence TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE
Gene ID - Mouse ENSMUSG00000020386
Gene ID - Rat ENSRNOG00000004820
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAR1B pAb (ATL-HPA048368)
Datasheet Anti SAR1B pAb (ATL-HPA048368) Datasheet (External Link)
Vendor Page Anti SAR1B pAb (ATL-HPA048368) at Atlas Antibodies

Documents & Links for Anti SAR1B pAb (ATL-HPA048368)
Datasheet Anti SAR1B pAb (ATL-HPA048368) Datasheet (External Link)
Vendor Page Anti SAR1B pAb (ATL-HPA048368)