Anti SAP30L pAb (ATL-HPA078308)

Atlas Antibodies

Catalog No.:
ATL-HPA078308-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SAP30 like
Gene Name: SAP30L
Alternative Gene Name: FLJ11526, NS4ATP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020519: 94%, ENSRNOG00000002575: 94%
Entrez Gene ID: 79685
Uniprot ID: Q9HAJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIE
Gene Sequence MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIE
Gene ID - Mouse ENSMUSG00000020519
Gene ID - Rat ENSRNOG00000002575
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAP30L pAb (ATL-HPA078308)
Datasheet Anti SAP30L pAb (ATL-HPA078308) Datasheet (External Link)
Vendor Page Anti SAP30L pAb (ATL-HPA078308) at Atlas Antibodies

Documents & Links for Anti SAP30L pAb (ATL-HPA078308)
Datasheet Anti SAP30L pAb (ATL-HPA078308) Datasheet (External Link)
Vendor Page Anti SAP30L pAb (ATL-HPA078308)