Anti SAP25 pAb (ATL-HPA062610)

Atlas Antibodies

Catalog No.:
ATL-HPA062610-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Sin3A-associated protein, 25kDa
Gene Name: SAP25
Alternative Gene Name: FLJ00248
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079165: 55%, ENSRNOG00000051023: 57%
Entrez Gene ID: 100316904
Uniprot ID: Q8TEE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSL
Gene Sequence TGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSL
Gene ID - Mouse ENSMUSG00000079165
Gene ID - Rat ENSRNOG00000051023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAP25 pAb (ATL-HPA062610)
Datasheet Anti SAP25 pAb (ATL-HPA062610) Datasheet (External Link)
Vendor Page Anti SAP25 pAb (ATL-HPA062610) at Atlas Antibodies

Documents & Links for Anti SAP25 pAb (ATL-HPA062610)
Datasheet Anti SAP25 pAb (ATL-HPA062610) Datasheet (External Link)
Vendor Page Anti SAP25 pAb (ATL-HPA062610)