Anti SAP25 pAb (ATL-HPA062610)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062610-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SAP25
Alternative Gene Name: FLJ00248
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079165: 55%, ENSRNOG00000051023: 57%
Entrez Gene ID: 100316904
Uniprot ID: Q8TEE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSL |
Gene Sequence | TGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSL |
Gene ID - Mouse | ENSMUSG00000079165 |
Gene ID - Rat | ENSRNOG00000051023 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SAP25 pAb (ATL-HPA062610) | |
Datasheet | Anti SAP25 pAb (ATL-HPA062610) Datasheet (External Link) |
Vendor Page | Anti SAP25 pAb (ATL-HPA062610) at Atlas Antibodies |
Documents & Links for Anti SAP25 pAb (ATL-HPA062610) | |
Datasheet | Anti SAP25 pAb (ATL-HPA062610) Datasheet (External Link) |
Vendor Page | Anti SAP25 pAb (ATL-HPA062610) |