Anti SAMD9L pAb (ATL-HPA019461 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019461-25

Protein Description: sterile alpha motif domain containing 9-like
Gene Name: SAMD9L
Alternative Gene Name: C7orf6, FLJ39885, KIAA2005
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047735: 67%, ENSRNOG00000051922: 67%
Entrez Gene ID: 219285
Uniprot ID: Q8IVG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECYLALSKFTSHLKNLQSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKESQLLQEENCRKKLEALRADRFAGLLEYLNPNYKDAT
• Gene Sequence: ECYLALSKFTSHLKNLQSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKESQLLQEENCRKKLEALRADRFAGLLEYLNPNYKDAT
• Gene ID - Mouse: ENSMUSG00000047735
• Gene ID - Rat: ENSRNOG00000051922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SAMD9L pAb (ATL-HPA019461 w/enhanced validation) – 2 Found

Hensel, Jonathan; Duex, Jason E; Owens, Charles; Dancik, Garrett M; Edwards, Michael G; Frierson, Henry F; Theodorescu, Dan. Patient Mutation Directed shRNA Screen Uncovers Novel Bladder Tumor Growth Suppressors. Molecular Cancer Research : Mcr. 2015;13(9):1306-15. 

Hastie, Eric; Cataldi, Marcela; Moerdyk-Schauwecker, Megan J; Felt, Sébastien A; Steuerwald, Nury; Grdzelishvili, Valery Z. Novel biomarkers of resistance of pancreatic cancer cells to oncolytic vesicular stomatitis virus. Oncotarget. 2016;7(38):61601-61618.