Anti SAMD9 pAb (ATL-HPA021318)

Atlas Antibodies

Catalog No.: ATL-HPA021318-25

Protein Description: sterile alpha motif domain containing 9
Gene Name: SAMD9
Alternative Gene Name: C7orf5, FLJ20073, KIAA2004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049470: 30%, ENSRNOG00000052444: 49%
Entrez Gene ID: 54809
Uniprot ID: Q5K651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSQKERRETSKQKQKGKENPDMANPSAMSTTAKGSKSLKVELIEDKIDYTKERQPSIDLTCVSYPFDEFSNPYRYKLDFSLQP
• Gene Sequence: VSQKERRETSKQKQKGKENPDMANPSAMSTTAKGSKSLKVELIEDKIDYTKERQPSIDLTCVSYPFDEFSNPYRYKLDFSLQP
• Gene ID - Mouse: ENSMUSG00000049470
• Gene ID - Rat: ENSRNOG00000052444
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SAMD9 pAb (ATL-HPA021318) – 2 Found

Jiang, Jieyuan; Opanubi, Kolawole J; Coombs, Kevin M. Non-Biased Enrichment Does Not Improve Quantitative Proteomic Delineation of Reovirus T3D-Infected HeLa Cell Protein Alterations. Frontiers In Microbiology. 3( 23024642):310. 

Coombs, Kevin M. HeLa cell response proteome alterations induced by mammalian reovirus T3D infection. Virology Journal. 2013;10( 23799967):202.