Anti SAMD5 pAb (ATL-HPA067811)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067811-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SAMD5
Alternative Gene Name: dJ875H10.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060487: 100%, ENSRNOG00000023549: 100%
Entrez Gene ID: 389432
Uniprot ID: Q5TGI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL |
| Gene Sequence | MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL |
| Gene ID - Mouse | ENSMUSG00000060487 |
| Gene ID - Rat | ENSRNOG00000023549 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SAMD5 pAb (ATL-HPA067811) | |
| Datasheet | Anti SAMD5 pAb (ATL-HPA067811) Datasheet (External Link) |
| Vendor Page | Anti SAMD5 pAb (ATL-HPA067811) at Atlas Antibodies |
| Documents & Links for Anti SAMD5 pAb (ATL-HPA067811) | |
| Datasheet | Anti SAMD5 pAb (ATL-HPA067811) Datasheet (External Link) |
| Vendor Page | Anti SAMD5 pAb (ATL-HPA067811) |