Anti SAMD4B pAb (ATL-HPA059385)

Atlas Antibodies

Catalog No.:
ATL-HPA059385-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sterile alpha motif domain containing 4B
Gene Name: SAMD4B
Alternative Gene Name: FLJ10211, hSmaug2, MGC99832, SMGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109336: 79%, ENSRNOG00000019831: 80%
Entrez Gene ID: 55095
Uniprot ID: Q5PRF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP
Gene Sequence IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP
Gene ID - Mouse ENSMUSG00000109336
Gene ID - Rat ENSRNOG00000019831
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAMD4B pAb (ATL-HPA059385)
Datasheet Anti SAMD4B pAb (ATL-HPA059385) Datasheet (External Link)
Vendor Page Anti SAMD4B pAb (ATL-HPA059385) at Atlas Antibodies

Documents & Links for Anti SAMD4B pAb (ATL-HPA059385)
Datasheet Anti SAMD4B pAb (ATL-HPA059385) Datasheet (External Link)
Vendor Page Anti SAMD4B pAb (ATL-HPA059385)