Anti SAMD4B pAb (ATL-HPA059385)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059385-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SAMD4B
Alternative Gene Name: FLJ10211, hSmaug2, MGC99832, SMGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109336: 79%, ENSRNOG00000019831: 80%
Entrez Gene ID: 55095
Uniprot ID: Q5PRF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP |
Gene Sequence | IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP |
Gene ID - Mouse | ENSMUSG00000109336 |
Gene ID - Rat | ENSRNOG00000019831 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SAMD4B pAb (ATL-HPA059385) | |
Datasheet | Anti SAMD4B pAb (ATL-HPA059385) Datasheet (External Link) |
Vendor Page | Anti SAMD4B pAb (ATL-HPA059385) at Atlas Antibodies |
Documents & Links for Anti SAMD4B pAb (ATL-HPA059385) | |
Datasheet | Anti SAMD4B pAb (ATL-HPA059385) Datasheet (External Link) |
Vendor Page | Anti SAMD4B pAb (ATL-HPA059385) |