Anti SAMD1 pAb (ATL-HPA049059)

Atlas Antibodies

Catalog No.:
ATL-HPA049059-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sterile alpha motif domain containing 1
Gene Name: SAMD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079003: 98%, ENSRNOG00000052637: 98%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGKPALPGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAFQE
Gene Sequence PGKPALPGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAFQE
Gene ID - Mouse ENSMUSG00000079003
Gene ID - Rat ENSRNOG00000052637
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAMD1 pAb (ATL-HPA049059)
Datasheet Anti SAMD1 pAb (ATL-HPA049059) Datasheet (External Link)
Vendor Page Anti SAMD1 pAb (ATL-HPA049059) at Atlas Antibodies

Documents & Links for Anti SAMD1 pAb (ATL-HPA049059)
Datasheet Anti SAMD1 pAb (ATL-HPA049059) Datasheet (External Link)
Vendor Page Anti SAMD1 pAb (ATL-HPA049059)