Anti SALL3 pAb (ATL-HPA016656)

Atlas Antibodies

Catalog No.: ATL-HPA016656-25

Protein Description: spalt-like transcription factor 3
Gene Name: SALL3
Alternative Gene Name: ZNF796
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024565: 83%, ENSRNOG00000026116: 83%
Entrez Gene ID: 27164
Uniprot ID: Q9BXA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AYDDKNAETLSSYDDDMDENSMEDDAELKDAATDPAKPLLSYAGSCPPSPPSVISSIAALENQMKMIDSVMSCQQLTGLKSVENGSGE
• Gene Sequence: AYDDKNAETLSSYDDDMDENSMEDDAELKDAATDPAKPLLSYAGSCPPSPPSVISSIAALENQMKMIDSVMSCQQLTGLKSVENGSGE
• Gene ID - Mouse: ENSMUSG00000024565
• Gene ID - Rat: ENSRNOG00000026116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SALL3 pAb (ATL-HPA016656) – 2 Found

de Melo, Jimmy; Peng, Guang-Hua; Chen, Shiming; Blackshaw, Seth. The Spalt family transcription factor Sall3 regulates the development of cone photoreceptors and retinal horizontal interneurons. Development (Cambridge, England). 2011;138(11):2325-36. 

Trujillo-Gonzalez, Isis; Friday, Walter B; Munson, Carolyn A; Bachleda, Amelia; Weiss, Ellen R; Alam, Nazia M; Sha, Wei; Zeisel, Steven H; Surzenko, Natalia. Low availability of choline in utero disrupts development and function of the retina. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2019;33(8):9194-9209.