Anti SALL1 pAb (ATL-HPA049829)

Atlas Antibodies

SKU:
ATL-HPA049829-25
  • Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: spalt-like transcription factor 1
Gene Name: SALL1
Alternative Gene Name: Hsal1, TBS, ZNF794
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031665: 75%, ENSRNOG00000013907: 75%
Entrez Gene ID: 6299
Uniprot ID: Q9NSC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPT
Gene Sequence TLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPT
Gene ID - Mouse ENSMUSG00000031665
Gene ID - Rat ENSRNOG00000013907
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SALL1 pAb (ATL-HPA049829)
Datasheet Anti SALL1 pAb (ATL-HPA049829) Datasheet (External Link)
Vendor Page Anti SALL1 pAb (ATL-HPA049829) at Atlas Antibodies

Documents & Links for Anti SALL1 pAb (ATL-HPA049829)
Datasheet Anti SALL1 pAb (ATL-HPA049829) Datasheet (External Link)
Vendor Page Anti SALL1 pAb (ATL-HPA049829)