Anti SAFB2 pAb (ATL-HPA050894)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050894-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SAFB2
Alternative Gene Name: KIAA0138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042625: 51%, ENSRNOG00000049511: 41%
Entrez Gene ID: 9667
Uniprot ID: Q14151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESL |
Gene Sequence | NMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESL |
Gene ID - Mouse | ENSMUSG00000042625 |
Gene ID - Rat | ENSRNOG00000049511 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SAFB2 pAb (ATL-HPA050894) | |
Datasheet | Anti SAFB2 pAb (ATL-HPA050894) Datasheet (External Link) |
Vendor Page | Anti SAFB2 pAb (ATL-HPA050894) at Atlas Antibodies |
Documents & Links for Anti SAFB2 pAb (ATL-HPA050894) | |
Datasheet | Anti SAFB2 pAb (ATL-HPA050894) Datasheet (External Link) |
Vendor Page | Anti SAFB2 pAb (ATL-HPA050894) |