Anti SAFB2 pAb (ATL-HPA050894)

Atlas Antibodies

Catalog No.:
ATL-HPA050894-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: scaffold attachment factor B2
Gene Name: SAFB2
Alternative Gene Name: KIAA0138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042625: 51%, ENSRNOG00000049511: 41%
Entrez Gene ID: 9667
Uniprot ID: Q14151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESL
Gene Sequence NMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESL
Gene ID - Mouse ENSMUSG00000042625
Gene ID - Rat ENSRNOG00000049511
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAFB2 pAb (ATL-HPA050894)
Datasheet Anti SAFB2 pAb (ATL-HPA050894) Datasheet (External Link)
Vendor Page Anti SAFB2 pAb (ATL-HPA050894) at Atlas Antibodies

Documents & Links for Anti SAFB2 pAb (ATL-HPA050894)
Datasheet Anti SAFB2 pAb (ATL-HPA050894) Datasheet (External Link)
Vendor Page Anti SAFB2 pAb (ATL-HPA050894)