Anti S1PR1 pAb (ATL-HPA075568)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075568-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: S1PR1
Alternative Gene Name: CD363, D1S3362, edg-1, EDG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045092: 81%, ENSRNOG00000013683: 75%
Entrez Gene ID: 1901
Uniprot ID: P21453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT |
| Gene Sequence | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT |
| Gene ID - Mouse | ENSMUSG00000045092 |
| Gene ID - Rat | ENSRNOG00000013683 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti S1PR1 pAb (ATL-HPA075568) | |
| Datasheet | Anti S1PR1 pAb (ATL-HPA075568) Datasheet (External Link) |
| Vendor Page | Anti S1PR1 pAb (ATL-HPA075568) at Atlas Antibodies |
| Documents & Links for Anti S1PR1 pAb (ATL-HPA075568) | |
| Datasheet | Anti S1PR1 pAb (ATL-HPA075568) Datasheet (External Link) |
| Vendor Page | Anti S1PR1 pAb (ATL-HPA075568) |