Anti S1PR1 pAb (ATL-HPA075568)

Atlas Antibodies

Catalog No.: ATL-HPA075568-25

Protein Description: sphingosine-1-phosphate receptor 1
Gene Name: S1PR1
Alternative Gene Name: CD363, D1S3362, edg-1, EDG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045092: 81%, ENSRNOG00000013683: 75%
Entrez Gene ID: 1901
Uniprot ID: P21453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
• Gene Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
• Gene ID - Mouse: ENSMUSG00000045092
• Gene ID - Rat: ENSRNOG00000013683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.