Anti S1PR1 pAb (ATL-HPA075568)

Atlas Antibodies

Catalog No.:
ATL-HPA075568-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sphingosine-1-phosphate receptor 1
Gene Name: S1PR1
Alternative Gene Name: CD363, D1S3362, edg-1, EDG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045092: 81%, ENSRNOG00000013683: 75%
Entrez Gene ID: 1901
Uniprot ID: P21453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
Gene Sequence MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
Gene ID - Mouse ENSMUSG00000045092
Gene ID - Rat ENSRNOG00000013683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti S1PR1 pAb (ATL-HPA075568)
Datasheet Anti S1PR1 pAb (ATL-HPA075568) Datasheet (External Link)
Vendor Page Anti S1PR1 pAb (ATL-HPA075568) at Atlas Antibodies

Documents & Links for Anti S1PR1 pAb (ATL-HPA075568)
Datasheet Anti S1PR1 pAb (ATL-HPA075568) Datasheet (External Link)
Vendor Page Anti S1PR1 pAb (ATL-HPA075568)