Anti S100Z pAb (ATL-HPA051929)

Atlas Antibodies

Catalog No.:
ATL-HPA051929-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: S100 calcium binding protein Z
Gene Name: S100Z
Alternative Gene Name: Gm625, S100-zeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021679: 83%, ENSRNOG00000017998: 80%
Entrez Gene ID: 170591
Uniprot ID: Q8WXG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPTQLEMAMDTMIRIFHRYSGKARKRFKLS
Gene Sequence MPTQLEMAMDTMIRIFHRYSGKARKRFKLS
Gene ID - Mouse ENSMUSG00000021679
Gene ID - Rat ENSRNOG00000017998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti S100Z pAb (ATL-HPA051929)
Datasheet Anti S100Z pAb (ATL-HPA051929) Datasheet (External Link)
Vendor Page Anti S100Z pAb (ATL-HPA051929) at Atlas Antibodies

Documents & Links for Anti S100Z pAb (ATL-HPA051929)
Datasheet Anti S100Z pAb (ATL-HPA051929) Datasheet (External Link)
Vendor Page Anti S100Z pAb (ATL-HPA051929)