Anti S100Z pAb (ATL-HPA051929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051929-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: S100Z
Alternative Gene Name: Gm625, S100-zeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021679: 83%, ENSRNOG00000017998: 80%
Entrez Gene ID: 170591
Uniprot ID: Q8WXG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPTQLEMAMDTMIRIFHRYSGKARKRFKLS |
| Gene Sequence | MPTQLEMAMDTMIRIFHRYSGKARKRFKLS |
| Gene ID - Mouse | ENSMUSG00000021679 |
| Gene ID - Rat | ENSRNOG00000017998 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti S100Z pAb (ATL-HPA051929) | |
| Datasheet | Anti S100Z pAb (ATL-HPA051929) Datasheet (External Link) |
| Vendor Page | Anti S100Z pAb (ATL-HPA051929) at Atlas Antibodies |
| Documents & Links for Anti S100Z pAb (ATL-HPA051929) | |
| Datasheet | Anti S100Z pAb (ATL-HPA051929) Datasheet (External Link) |
| Vendor Page | Anti S100Z pAb (ATL-HPA051929) |