Anti S100G pAb (ATL-HPA055873 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055873-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: S100 calcium binding protein G
Gene Name: S100G
Alternative Gene Name: CABP1, CABP9K, CALB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040808: 80%, ENSRNOG00000004222: 80%
Entrez Gene ID: 795
Uniprot ID: P29377
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDK
Gene Sequence KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDK
Gene ID - Mouse ENSMUSG00000040808
Gene ID - Rat ENSRNOG00000004222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti S100G pAb (ATL-HPA055873 w/enhanced validation)
Datasheet Anti S100G pAb (ATL-HPA055873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti S100G pAb (ATL-HPA055873 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti S100G pAb (ATL-HPA055873 w/enhanced validation)
Datasheet Anti S100G pAb (ATL-HPA055873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti S100G pAb (ATL-HPA055873 w/enhanced validation)