Anti S100A3 pAb (ATL-HPA056140)

Atlas Antibodies

SKU:
ATL-HPA056140-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: S100 calcium binding protein A3
Gene Name: S100A3
Alternative Gene Name: S100E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001021: 93%, ENSRNOG00000012008: 93%
Entrez Gene ID: 6274
Uniprot ID: P33764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQK
Gene Sequence MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQK
Gene ID - Mouse ENSMUSG00000001021
Gene ID - Rat ENSRNOG00000012008
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti S100A3 pAb (ATL-HPA056140)
Datasheet Anti S100A3 pAb (ATL-HPA056140) Datasheet (External Link)
Vendor Page Anti S100A3 pAb (ATL-HPA056140) at Atlas Antibodies

Documents & Links for Anti S100A3 pAb (ATL-HPA056140)
Datasheet Anti S100A3 pAb (ATL-HPA056140) Datasheet (External Link)
Vendor Page Anti S100A3 pAb (ATL-HPA056140)