Anti S100A3 pAb (ATL-HPA056140)

Atlas Antibodies

Catalog No.: ATL-HPA056140-25

Protein Description: S100 calcium binding protein A3
Gene Name: S100A3
Alternative Gene Name: S100E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001021: 93%, ENSRNOG00000012008: 93%
Entrez Gene ID: 6274
Uniprot ID: P33764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQK
• Gene Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQK
• Gene ID - Mouse: ENSMUSG00000001021
• Gene ID - Rat: ENSRNOG00000012008
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.