Anti RYR3 pAb (ATL-HPA062004)

Atlas Antibodies

Catalog No.:
ATL-HPA062004-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ryanodine receptor 3
Gene Name: RYR3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057378: 99%, ENSRNOG00000006645: 99%
Entrez Gene ID: 6263
Uniprot ID: Q15413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ
Gene Sequence TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ
Gene ID - Mouse ENSMUSG00000057378
Gene ID - Rat ENSRNOG00000006645
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RYR3 pAb (ATL-HPA062004)
Datasheet Anti RYR3 pAb (ATL-HPA062004) Datasheet (External Link)
Vendor Page Anti RYR3 pAb (ATL-HPA062004) at Atlas Antibodies

Documents & Links for Anti RYR3 pAb (ATL-HPA062004)
Datasheet Anti RYR3 pAb (ATL-HPA062004) Datasheet (External Link)
Vendor Page Anti RYR3 pAb (ATL-HPA062004)