Anti RYR3 pAb (ATL-HPA062004)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062004-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RYR3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057378: 99%, ENSRNOG00000006645: 99%
Entrez Gene ID: 6263
Uniprot ID: Q15413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ |
Gene Sequence | TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ |
Gene ID - Mouse | ENSMUSG00000057378 |
Gene ID - Rat | ENSRNOG00000006645 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RYR3 pAb (ATL-HPA062004) | |
Datasheet | Anti RYR3 pAb (ATL-HPA062004) Datasheet (External Link) |
Vendor Page | Anti RYR3 pAb (ATL-HPA062004) at Atlas Antibodies |
Documents & Links for Anti RYR3 pAb (ATL-HPA062004) | |
Datasheet | Anti RYR3 pAb (ATL-HPA062004) Datasheet (External Link) |
Vendor Page | Anti RYR3 pAb (ATL-HPA062004) |