Anti RYR2 pAb (ATL-HPA020028 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020028-25

Protein Description: ryanodine receptor 2 (cardiac)
Gene Name: RYR2
Alternative Gene Name: ARVC2, ARVD2, VTSIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021313: 95%, ENSRNOG00000017060: 92%
Entrez Gene ID: 6262
Uniprot ID: Q92736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
• Gene Sequence: QDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
• Gene ID - Mouse: ENSMUSG00000021313
• Gene ID - Rat: ENSRNOG00000017060
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RYR2 pAb (ATL-HPA020028 w/enhanced validation) – 11 Found

Godier-Furnémont, Amandine F G; Tiburcy, Malte; Wagner, Eva; Dewenter, Matthias; Lämmle, Simon; El-Armouche, Ali; Lehnart, Stephan E; Vunjak-Novakovic, Gordana; Zimmermann, Wolfram-Hubertus. Physiologic force-frequency response in engineered heart muscle by electromechanical stimulation. Biomaterials. 2015;60( 25985155):82-91. 

Mustroph, Julian; Sag, Can M; Bähr, Felix; Schmidtmann, Anna-Lena; Gupta, Shamindra N; Dietz, Alexander; Islam, M M Towhidul; Lücht, Charlotte; Beuthner, Bo Eric; Pabel, Steffen; Baier, Maria J; El-Armouche, Ali; Sossalla, Samuel; Anderson, Mark E; Möllmann, Julia; Lehrke, Michael; Marx, Nikolaus; Mohler, Peter J; Bers, Donald M; Unsöld, Bernhard; He, Tao; Dewenter, Matthias; Backs, Johannes; Maier, Lars S; Wagner, Stefan. Loss of CASK Accelerates Heart Failure Development. Circulation Research. 2021;128(8):1139-1155. 

Brandenburg, Sören; Pawlowitz, Jan; Fakuade, Funsho E; Kownatzki-Danger, Daniel; Kohl, Tobias; Mitronova, Gyuzel Y; Scardigli, Marina; Neef, Jakob; Schmidt, Constanze; Wiedmann, Felix; Pavone, Francesco S; Sacconi, Leonardo; Kutschka, Ingo; Sossalla, Samuel; Moser, Tobias; Voigt, Niels; Lehnart, Stephan E. Axial Tubule Junctions Activate Atrial Ca(2+) Release Across Species. Frontiers In Physiology. 9( 30349482):1227. 

Poulet, Claire; Sanchez-Alonso, Jose; Swiatlowska, Pamela; Mouy, Florence; Lucarelli, Carla; Alvarez-Laviada, Anita; Gross, Polina; Terracciano, Cesare; Houser, Steven; Gorelik, Julia. Junctophilin-2 tethers T-tubules and recruits functional L-type calcium channels to lipid rafts in adult cardiomyocytes. Cardiovascular Research. 2021;117(1):149-161. 

Luo, Xiaojing; Li, Wener; Künzel, Karolina; Henze, Sarah; Cyganek, Lukas; Strano, Anna; Poetsch, Mareike S; Schubert, Mario; Guan, Kaomei. IP3R-Mediated Compensatory Mechanism for Calcium Handling in Human Induced Pluripotent Stem Cell-Derived Cardiomyocytes With Cardiac Ryanodine Receptor Deficiency. Frontiers In Cell And Developmental Biology. 8( 32903370):772. 

Pabel, Steffen; Reetz, Florian; Dybkova, Nataliya; Shomroni, Orr; Salinas, Gabriela; Mustroph, Julian; Hammer, Karin P; Hasenfuss, Gerd; Hamdani, Nazha; Maier, Lars S; Streckfuss-Bömeke, Katrin; Sossalla, Samuel. Long-term effects of empagliflozin on excitation-contraction-coupling in human induced pluripotent stem cell cardiomyocytes. Journal Of Molecular Medicine (Berlin, Germany). 2020;98(12):1689-1700. 

Kleinsorge, Mandy; Cyganek, Lukas. Subtype-Directed Differentiation of Human iPSCs into Atrial and Ventricular Cardiomyocytes. Star Protocols. 2020;1(1):100026. 

Munro, Michelle L; van Hout, Isabelle; Aitken-Buck, Hamish M; Sugunesegran, Ramanen; Bhagwat, Krishna; Davis, Philip J; Lamberts, Regis R; Coffey, Sean; Soeller, Christian; Jones, Peter P. Human Atrial Fibrillation Is Not Associated With Remodeling of Ryanodine Receptor Clusters. Frontiers In Cell And Developmental Biology. 9( 33718369):633704. 

Weninger, Gunnar; Pochechueva, Tatiana; El Chami, Dana; Luo, Xiaojing; Kohl, Tobias; Brandenburg, Sören; Urlaub, Henning; Guan, Kaomei; Lenz, Christof; Lehnart, Stephan E. Calpain cleavage of Junctophilin-2 generates a spectrum of calcium-dependent cleavage products and DNA-rich NT(1)-fragment domains in cardiomyocytes. Scientific Reports. 2022;12(1):10387. 

Wang, Yinuo; Elsherbiny, Adel; Kessler, Linda; Cordero, Julio; Shi, Haojie; Serke, Heike; Lityagina, Olga; Trogisch, Felix A; Mohammadi, Mona Malek; El-Battrawy, Ibrahim; Backs, Johannes; Wieland, Thomas; Heineke, Joerg; Dobreva, Gergana. Lamin A/C-dependent chromatin architecture safeguards naïve pluripotency to prevent aberrant cardiovascular cell fate and function. Nature Communications. 2022;13(1):6663. 

Cachorro, Eleder; Günscht, Mario; Schubert, Mario; Sadek, Mirna S; Siegert, Johanna; Dutt, Fabian; Bauermeister, Carla; Quickert, Susann; Berning, Henrik; Nowakowski, Felix; Lämmle, Simon; Firneburg, Rebecca; Luo, Xiaojing; Künzel, Stephan R; Klapproth, Erik; Mirtschink, Peter; Mayr, Manuel; Dewenter, Matthias; Vettel, Christiane; Heijman, Jordi; Lorenz, Kristina; Guan, Kaomei; El-Armouche, Ali; Wagner, Michael; Kämmerer, Susanne. CNP Promotes Antiarrhythmic Effects via Phosphodiesterase 2. Circulation Research. 2023;132(4):400-414.