Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056416-25
  • Immunohistochemistry analysis in human skeletal muscle and colon tissues using Anti-RYR1 antibody. Corresponding RYR1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SiHa shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ryanodine receptor 1 (skeletal)
Gene Name: RYR1
Alternative Gene Name: CCO, MHS, MHS1, PPP1R137, RYR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030592: 96%, ENSRNOG00000020557: 96%
Entrez Gene ID: 6261
Uniprot ID: P21817
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
Gene Sequence REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
Gene ID - Mouse ENSMUSG00000030592
Gene ID - Rat ENSRNOG00000020557
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation)
Datasheet Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation)
Datasheet Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation)



Citations for Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation) – 1 Found
Gonorazky, Hernan D; Naumenko, Sergey; Ramani, Arun K; Nelakuditi, Viswateja; Mashouri, Pouria; Wang, Peiqui; Kao, Dennis; Ohri, Krish; Viththiyapaskaran, Senthuri; Tarnopolsky, Mark A; Mathews, Katherine D; Moore, Steven A; Osorio, Andres N; Villanova, David; Kemaladewi, Dwi U; Cohn, Ronald D; Brudno, Michael; Dowling, James J. Expanding the Boundaries of RNA Sequencing as a Diagnostic Tool for Rare Mendelian Disease. American Journal Of Human Genetics. 2019;104(3):466-483.  PubMed