Anti RYK pAb (ATL-HPA075430)

Atlas Antibodies

Catalog No.: ATL-HPA075430-25

Protein Description: receptor-like tyrosine kinase
Gene Name: RYK
Alternative Gene Name: D3S3195, JTK5, JTK5A, RYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032547: 100%, ENSRNOG00000008593: 100%
Entrez Gene ID: 6259
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG
• Gene Sequence: LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG
• Gene ID - Mouse: ENSMUSG00000032547
• Gene ID - Rat: ENSRNOG00000008593
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.