Anti RYK pAb (ATL-HPA075430)

Atlas Antibodies

Catalog No.:
ATL-HPA075430-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: receptor-like tyrosine kinase
Gene Name: RYK
Alternative Gene Name: D3S3195, JTK5, JTK5A, RYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032547: 100%, ENSRNOG00000008593: 100%
Entrez Gene ID: 6259
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG
Gene Sequence LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG
Gene ID - Mouse ENSMUSG00000032547
Gene ID - Rat ENSRNOG00000008593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RYK pAb (ATL-HPA075430)
Datasheet Anti RYK pAb (ATL-HPA075430) Datasheet (External Link)
Vendor Page Anti RYK pAb (ATL-HPA075430) at Atlas Antibodies

Documents & Links for Anti RYK pAb (ATL-HPA075430)
Datasheet Anti RYK pAb (ATL-HPA075430) Datasheet (External Link)
Vendor Page Anti RYK pAb (ATL-HPA075430)