Anti RXFP1 pAb (ATL-HPA027067)

Atlas Antibodies

Catalog No.: ATL-HPA027067-25

Protein Description: relaxin/insulin-like family peptide receptor 1
Gene Name: RXFP1
Alternative Gene Name: LGR7, RXFPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034009: 71%, ENSRNOG00000024120: 74%
Entrez Gene ID: 59350
Uniprot ID: Q9HBX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS
• Gene Sequence: PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS
• Gene ID - Mouse: ENSMUSG00000034009
• Gene ID - Rat: ENSRNOG00000024120
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RXFP1 pAb (ATL-HPA027067) – 1 Found

Burston, Helen E; Kent, Oliver A; Communal, Laudine; Udaskin, Molly L; Sun, Ren X; Brown, Kevin R; Jung, Euihye; Francis, Kyle E; La Rose, Jose; Lowitz, Joshua; Drapkin, Ronny; Mes-Masson, Anne-Marie; Rottapel, Robert. Inhibition of relaxin autocrine signaling confers therapeutic vulnerability in ovarian cancer. The Journal Of Clinical Investigation. 2021;131(7)