Anti RWDD2B pAb (ATL-HPA018316 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018316-25

Protein Description: RWD domain containing 2B
Gene Name: RWDD2B
Alternative Gene Name: C21orf6, GL011
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041079: 82%, ENSRNOG00000001599: 84%
Entrez Gene ID: 10069
Uniprot ID: P57060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIRHREDIPFDGTNDETERQRKFSIFEEKVFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ
• Gene Sequence: LIRHREDIPFDGTNDETERQRKFSIFEEKVFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ
• Gene ID - Mouse: ENSMUSG00000041079
• Gene ID - Rat: ENSRNOG00000001599
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RWDD2B pAb (ATL-HPA018316 w/enhanced validation) – 1 Found

Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458.