Anti RWDD1 pAb (ATL-HPA028712)

Atlas Antibodies

Catalog No.:
ATL-HPA028712-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RWD domain containing 1
Gene Name: RWDD1
Alternative Gene Name: PTD013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019782: 97%, ENSRNOG00000042916: 97%
Entrez Gene ID: 51389
Uniprot ID: Q9H446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEI
Gene Sequence FTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEI
Gene ID - Mouse ENSMUSG00000019782
Gene ID - Rat ENSRNOG00000042916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RWDD1 pAb (ATL-HPA028712)
Datasheet Anti RWDD1 pAb (ATL-HPA028712) Datasheet (External Link)
Vendor Page Anti RWDD1 pAb (ATL-HPA028712) at Atlas Antibodies

Documents & Links for Anti RWDD1 pAb (ATL-HPA028712)
Datasheet Anti RWDD1 pAb (ATL-HPA028712) Datasheet (External Link)
Vendor Page Anti RWDD1 pAb (ATL-HPA028712)