Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA067966-25
  • Immunohistochemistry analysis in human testis and liver tissues using Anti-RUVBL2 antibody. Corresponding RUVBL2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, cytosol & centrosome.
  • Western blot analysis using Anti-RUVBL2 antibody HPA067966 (A) shows similar pattern to independent antibody HPA042880 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: RuvB-like AAA ATPase 2
Gene Name: RUVBL2
Alternative Gene Name: ECP51, INO80J, Reptin52, RVB2, TIH2, TIP48, TIP49b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003868: 97%, ENSRNOG00000020793: 97%
Entrez Gene ID: 10856
Uniprot ID: Q9Y230
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Gene Sequence ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Gene ID - Mouse ENSMUSG00000003868
Gene ID - Rat ENSRNOG00000020793
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)
Datasheet Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)