Anti RUVBL1 pAb (ATL-HPA019948 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019948-25

Protein Description: RuvB-like AAA ATPase 1
Gene Name: RUVBL1
Alternative Gene Name: ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030079: 100%, ENSRNOG00000013195: 100%
Entrez Gene ID: 8607
Uniprot ID: Q9Y265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG
• Gene Sequence: GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG
• Gene ID - Mouse: ENSMUSG00000030079
• Gene ID - Rat: ENSRNOG00000013195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RUVBL1 pAb (ATL-HPA019948 w/enhanced validation) – 2 Found

Da Ros, Matteo; Lehtiniemi, Tiina; Olotu, Opeyemi; Fischer, Daniel; Zhang, Fu-Ping; Vihinen, Helena; Jokitalo, Eija; Sironen, Anu; Toppari, Jorma; Kotaja, Noora. FYCO1 and autophagy control the integrity of the haploid male germ cell-specific RNP granules. Autophagy. 2017;13(2):302-321. 

Durślewicz, Justyna; Jóźwicki, Jakub; Klimaszewska-Wiśniewska, Anna; Zielińska, Aleksandra; Antosik, Paulina; Grzanka, Dariusz; Braun, Marcin. High expression of RUVBL1 and HNRNPU is associated with poor overall survival in stage I and II non-small cell lung cancer patients. Discover Oncology. 2022;13(1):106.