Anti RUVBL1 pAb (ATL-HPA019947 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019947-25

Protein Description: RuvB-like AAA ATPase 1
Gene Name: RUVBL1
Alternative Gene Name: ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030079: 100%, ENSRNOG00000013195: 100%
Entrez Gene ID: 8607
Uniprot ID: Q9Y265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV
• Gene Sequence: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV
• Gene ID - Mouse: ENSMUSG00000030079
• Gene ID - Rat: ENSRNOG00000013195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RUVBL1 pAb (ATL-HPA019947 w/enhanced validation) – 2 Found

Baron, Beverly W; Baron, Rebecca M; Baron, Joseph M. The Relationship between RUVBL1 (Pontin, TIP49, NMP238) and BCL6 in Benign and Malignant Human Lymphoid Tissues. Biochemistry And Biophysics Reports. 2016;6( 27066592):1-8. 

Tyleckova, Jirina; Hrabakova, Rita; Mairychova, Katerina; Halada, Petr; Radova, Lenka; Dzubak, Petr; Hajduch, Marian; Gadher, Suresh J; Kovarova, Hana. Cancer cell response to anthracyclines effects: mysteries of the hidden proteins associated with these drugs. International Journal Of Molecular Sciences. 2012;13(12):15536-64.