Anti RUSC1 pAb (ATL-HPA029923)

Atlas Antibodies

Catalog No.: ATL-HPA029923-25

Protein Description: RUN and SH3 domain containing 1
Gene Name: RUSC1
Alternative Gene Name: NESCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000105204: 79%, ENSRNOG00000043377: 80%
Entrez Gene ID: 23623
Uniprot ID: Q9BVN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCG
• Gene Sequence: RRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCG
• Gene ID - Mouse: ENSMUSG00000105204
• Gene ID - Rat: ENSRNOG00000043377
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.