Anti RUNX1T1 pAb (ATL-HPA070951)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070951-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RUNX1T1
Alternative Gene Name: AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006586: 94%, ENSRNOG00000005673: 94%
Entrez Gene ID: 862
Uniprot ID: Q06455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT |
| Gene Sequence | RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT |
| Gene ID - Mouse | ENSMUSG00000006586 |
| Gene ID - Rat | ENSRNOG00000005673 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RUNX1T1 pAb (ATL-HPA070951) | |
| Datasheet | Anti RUNX1T1 pAb (ATL-HPA070951) Datasheet (External Link) |
| Vendor Page | Anti RUNX1T1 pAb (ATL-HPA070951) at Atlas Antibodies |
| Documents & Links for Anti RUNX1T1 pAb (ATL-HPA070951) | |
| Datasheet | Anti RUNX1T1 pAb (ATL-HPA070951) Datasheet (External Link) |
| Vendor Page | Anti RUNX1T1 pAb (ATL-HPA070951) |