Anti RUNX1T1 pAb (ATL-HPA070951)

Atlas Antibodies

Catalog No.:
ATL-HPA070951-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Gene Name: RUNX1T1
Alternative Gene Name: AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006586: 94%, ENSRNOG00000005673: 94%
Entrez Gene ID: 862
Uniprot ID: Q06455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT
Gene Sequence RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT
Gene ID - Mouse ENSMUSG00000006586
Gene ID - Rat ENSRNOG00000005673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RUNX1T1 pAb (ATL-HPA070951)
Datasheet Anti RUNX1T1 pAb (ATL-HPA070951) Datasheet (External Link)
Vendor Page Anti RUNX1T1 pAb (ATL-HPA070951) at Atlas Antibodies

Documents & Links for Anti RUNX1T1 pAb (ATL-HPA070951)
Datasheet Anti RUNX1T1 pAb (ATL-HPA070951) Datasheet (External Link)
Vendor Page Anti RUNX1T1 pAb (ATL-HPA070951)