Anti RUNX1 pAb (ATL-HPA037912)

Atlas Antibodies

Catalog No.: ATL-HPA037912-25

Protein Description: runt-related transcription factor 1
Gene Name: RUNX1
Alternative Gene Name: AML1, AMLCR1, CBFA2, PEBP2A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022952: 100%, ENSRNOG00000001704: 100%
Entrez Gene ID: 861
Uniprot ID: Q01196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN
• Gene Sequence: LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN
• Gene ID - Mouse: ENSMUSG00000022952
• Gene ID - Rat: ENSRNOG00000001704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.