Anti RUNX1 pAb (ATL-HPA037912)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037912-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: RUNX1
Alternative Gene Name: AML1, AMLCR1, CBFA2, PEBP2A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022952: 100%, ENSRNOG00000001704: 100%
Entrez Gene ID: 861
Uniprot ID: Q01196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN |
Gene Sequence | LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN |
Gene ID - Mouse | ENSMUSG00000022952 |
Gene ID - Rat | ENSRNOG00000001704 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RUNX1 pAb (ATL-HPA037912) | |
Datasheet | Anti RUNX1 pAb (ATL-HPA037912) Datasheet (External Link) |
Vendor Page | Anti RUNX1 pAb (ATL-HPA037912) at Atlas Antibodies |
Documents & Links for Anti RUNX1 pAb (ATL-HPA037912) | |
Datasheet | Anti RUNX1 pAb (ATL-HPA037912) Datasheet (External Link) |
Vendor Page | Anti RUNX1 pAb (ATL-HPA037912) |