Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004176-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: RUNX1
Alternative Gene Name: AML1, AMLCR1, CBFA2, PEBP2A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022952: 93%, ENSRNOG00000001704: 93%
Entrez Gene ID: 861
Uniprot ID: Q01196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI |
| Gene Sequence | PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI |
| Gene ID - Mouse | ENSMUSG00000022952 |
| Gene ID - Rat | ENSRNOG00000001704 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation) | |
| Datasheet | Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation) | |
| Datasheet | Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation) |
| Citations for Anti RUNX1 pAb (ATL-HPA004176 w/enhanced validation) – 5 Found |
| Debaize, Lydie; Jakobczyk, Hélène; Avner, Stéphane; Gaudichon, Jérémie; Rio, Anne-Gaëlle; Sérandour, Aurélien A; Dorsheimer, Lena; Chalmel, Frédéric; Carroll, Jason S; Zörnig, Martin; Rieger, Michael A; Delalande, Olivier; Salbert, Gilles; Galibert, Marie-Dominique; Gandemer, Virginie; Troadec, Marie-Bérengère. Interplay between transcription regulators RUNX1 and FUBP1 activates an enhancer of the oncogene c-KIT and amplifies cell proliferation. Nucleic Acids Research. 2018;46(21):11214-11228. PubMed |
| O'Hare, Michael; Amarnani, Dhanesh; Whitmore, Hannah A B; An, Miranda; Marino, Claudia; Ramos, Leslie; Delgado-Tirado, Santiago; Hu, Xinyao; Chmielewska, Natalia; Chandrahas, Anita; Fitzek, Antonia; Heinrich, Fabian; Steurer, Stefan; Ondruschka, Benjamin; Glatzel, Markus; Krasemann, Susanne; Sepulveda-Falla, Diego; Lagares, David; Pedron, Julien; Bushweller, John H; Liu, Paul; Arboleda-Velasquez, Joseph F; Kim, Leo A. Targeting Runt-Related Transcription Factor 1 Prevents Pulmonary Fibrosis and Reduces Expression of Severe Acute Respiratory Syndrome Coronavirus 2 Host Mediators. The American Journal Of Pathology. 2021;191(7):1193-1208. PubMed |
| Li, Zhijian; Kuppe, Christoph; Ziegler, Susanne; Cheng, Mingbo; Kabgani, Nazanin; Menzel, Sylvia; Zenke, Martin; Kramann, Rafael; Costa, Ivan G. Chromatin-accessibility estimation from single-cell ATAC-seq data with scOpen. Nature Communications. 2021;12(1):6386. PubMed |
| Ferrari, Nicola; Mohammed, Zahra M A; Nixon, Colin; Mason, Susan M; Mallon, Elizabeth; McMillan, Donald C; Morris, Joanna S; Cameron, Ewan R; Edwards, Joanne; Blyth, Karen. Expression of RUNX1 correlates with poor patient prognosis in triple negative breast cancer. Plos One. 9(6):e100759. PubMed |
| Raha-Chowdhury, Ruma; Raha, Animesh Alexander; Henderson, James; Ghaffari, Seyedeh Deniz; Grigorova, Monika; Beresford-Webb, Jessica; Allinson, Kieren; Chakraborty, Subhojit; Holland, Anthony; Zaman, Shahid H. Impaired Iron Homeostasis and Haematopoiesis Impacts Inflammation in the Ageing Process in Down Syndrome Dementia. Journal Of Clinical Medicine. 2021;10(13) PubMed |