Anti RUNDC3B pAb (ATL-HPA057155)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057155-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RUNDC3B
Alternative Gene Name: RPIB9, RPIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040570: 83%, ENSRNOG00000008463: 85%
Entrez Gene ID: 154661
Uniprot ID: Q96NL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNVMSEGKEDTPS |
Gene Sequence | EKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNVMSEGKEDTPS |
Gene ID - Mouse | ENSMUSG00000040570 |
Gene ID - Rat | ENSRNOG00000008463 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RUNDC3B pAb (ATL-HPA057155) | |
Datasheet | Anti RUNDC3B pAb (ATL-HPA057155) Datasheet (External Link) |
Vendor Page | Anti RUNDC3B pAb (ATL-HPA057155) at Atlas Antibodies |
Documents & Links for Anti RUNDC3B pAb (ATL-HPA057155) | |
Datasheet | Anti RUNDC3B pAb (ATL-HPA057155) Datasheet (External Link) |
Vendor Page | Anti RUNDC3B pAb (ATL-HPA057155) |