Anti RUNDC3B pAb (ATL-HPA057155)

Atlas Antibodies

SKU:
ATL-HPA057155-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in endocrine cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RUN domain containing 3B
Gene Name: RUNDC3B
Alternative Gene Name: RPIB9, RPIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040570: 83%, ENSRNOG00000008463: 85%
Entrez Gene ID: 154661
Uniprot ID: Q96NL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNVMSEGKEDTPS
Gene Sequence EKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNVMSEGKEDTPS
Gene ID - Mouse ENSMUSG00000040570
Gene ID - Rat ENSRNOG00000008463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RUNDC3B pAb (ATL-HPA057155)
Datasheet Anti RUNDC3B pAb (ATL-HPA057155) Datasheet (External Link)
Vendor Page Anti RUNDC3B pAb (ATL-HPA057155) at Atlas Antibodies

Documents & Links for Anti RUNDC3B pAb (ATL-HPA057155)
Datasheet Anti RUNDC3B pAb (ATL-HPA057155) Datasheet (External Link)
Vendor Page Anti RUNDC3B pAb (ATL-HPA057155)