Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA070733-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RUN domain containing 3A
Gene Name: RUNDC3A
Alternative Gene Name: RAP2IP, RPIP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006575: 98%, ENSRNOG00000020970: 98%
Entrez Gene ID: 10900
Uniprot ID: Q59EK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK
Gene Sequence TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK
Gene ID - Mouse ENSMUSG00000006575
Gene ID - Rat ENSRNOG00000020970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation)
Datasheet Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation)
Datasheet Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation)