Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA070733-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RUNDC3A
Alternative Gene Name: RAP2IP, RPIP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006575: 98%, ENSRNOG00000020970: 98%
Entrez Gene ID: 10900
Uniprot ID: Q59EK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK |
Gene Sequence | TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK |
Gene ID - Mouse | ENSMUSG00000006575 |
Gene ID - Rat | ENSRNOG00000020970 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) | |
Datasheet | Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) | |
Datasheet | Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation) |